General Information

  • ID:  hor004145
  • Uniprot ID:  NA
  • Protein name:  Corticotropin-releasing hormone
  • Gene name:  NA
  • Organism:  Scyliorhinus canicula
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  NA
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  PAETPNSLDLTFHLLREMIEIAKHENQQMQADSNRRIMDTI
  • Length:  41
  • Propeptide:  NA
  • Signal peptide:  NA
  • Modification:  T41 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004145_AF2.pdbhor004145_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 552211 Formula: C204H333N61O67S3
Absent amino acids: CGVWY Common amino acids: EIL
pI: 4.81 Basic residues: 6
Polar residues: 8 Hydrophobic residues: 12
Hydrophobicity: -70.98 Boman Index: -10926
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 83.41
Instability Index: 5130.73 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  8536945
  • Title:  A Peptide From the Caudal Neurosecretory System of the Dogfish Scyliorhinus Canicula That Is Structurally Related to Urotensin I